PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00000138001
Common NameGSBRNA2T00000138001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 339aa    MW: 36710.5 Da    PI: 7.8914
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00000138001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.1e-3842101463
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                          +al+cprC+s ntkfCyynnysl+qPryfCk C+ryWt+GG+lrn+P+Ggg rknk+sss
  GSBRNA2T00000138001  42 HALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCKRYWTQGGSLRNIPIGGGVRKNKRSSS 101
                          6799****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-282692IPR003851Zinc finger, Dof-type
PfamPF027016.9E-334398IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5464498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDIAKWPQKE FIVKPMNETC LKQPNPAAAP VEEKKARPEK YHALNCPRCN SLNTKFCYYN  60
NYSLTQPRYF CKDCKRYWTQ GGSLRNIPIG GGVRKNKRSS SSSSSNSNSA SSSKKTLSVN  120
NKTPPPLQQL NLKTVENDHV AKACSHGFGN AHEAKDLNSA FSQGFEIGHH HHHHHQSIPE  180
FLQVVPSSMK NHTFVSTSSA LELLGISNSS TTSSNSSPAF VTYPNVHDSS VYTAASPGFG  240
MSYPQFQEFM RPPLGFSLDG GDSLHLEEGS SGTDNGRPLL PFESLKLHVS SSSTNSGGGN  300
GNDHEREKEE GEADNSVGFW NGMLSAGDSA ASAGGPWQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00210DAPTransfer from AT1G64620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00000138001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608859.10.0PREDICTED: dof zinc finger protein DOF1.8 isoform X1
SwissprotQ84JQ81e-135DOF18_ARATH; Dof zinc finger protein DOF1.8
TrEMBLA0A078F5M30.0A0A078F5M3_BRANA; BnaC09g12040D protein
STRINGBra027722.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149321720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.11e-127Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]